Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

ErbB2/Her2 antibody (AA 29-64)

The Rabbit Polyclonal anti-ErbB2/Her2 antibody has been validated for WB and IHC (p). It is suitable to detect ErbB2/Her2 in samples from Human and Rat.
Catalog No. ABIN5708082

Quick Overview for ErbB2/Her2 antibody (AA 29-64) (ABIN5708082)

Target

See all ErbB2/Her2 Antibodies
ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

Reactivity

  • 477
  • 122
  • 118
  • 33
  • 8
  • 5
  • 3
  • 3
  • 3
  • 3
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Human, Rat

Host

  • 302
  • 184
  • 10
  • 6
  • 3
  • 2
  • 2
  • 2
Rabbit

Clonality

  • 281
  • 225
  • 3
Polyclonal

Conjugate

  • 282
  • 28
  • 20
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 8
  • 7
  • 7
  • 7
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 6
  • 5
  • 3
  • 2
  • 2
  • 1
This ErbB2/Her2 antibody is un-conjugated

Application

  • 307
  • 139
  • 136
  • 126
  • 125
  • 93
  • 80
  • 57
  • 57
  • 53
  • 46
  • 30
  • 29
  • 12
  • 9
  • 8
  • 6
  • 5
  • 3
  • 3
  • 2
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
  • 1
Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
  • Binding Specificity

    • 41
    • 38
    • 34
    • 28
    • 25
    • 24
    • 21
    • 17
    • 17
    • 15
    • 13
    • 12
    • 7
    • 6
    • 5
    • 5
    • 5
    • 5
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    AA 29-64

    Purification

    Antigen affinity purified

    Immunogen

    Amino acids 29-64 (TDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTY) from the human protein were used as the immunogen for the HER2 antibody.

    Isotype

    IgG
  • Application Notes

    Optimal dilution of the HER2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL,IHC (FFPE): 1-2 μg/mL

    Restrictions

    For Research Use only
  • Buffer

    0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

    Storage

    -20 °C

    Storage Comment

    After reconstitution, the HER2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
  • Target

    ErbB2/Her2 (Receptor tyrosine-protein kinase erbB-2 (ErbB2/Her2))

    Alternative Name

    HER2 / ErbB 2

    Background

    Receptor tyrosine-protein kinase erbB-2, also known as CD340 (cluster of differentiation 340), proto-oncogene Neu, Erbb2 (rodent), or ERBB2 (human), is a protein that in humans is encoded by the ERBB2 gene. And it is also frequently called HER2 (from human epidermal growth factor receptor 2) or HER2/neu. This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

    UniProt

    P04626

    Pathways

    RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Skeletal Muscle Fiber Development
You are here:
Chat with us!